SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026170 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026170
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily Immunoglobulin 6.77e-26
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026170   Gene: ENSGGOG00000000630   Transcript: ENSGGOT00000026452
Sequence length 123
Comment pep:known_by_projection chromosome:gorGor3.1:22:7608916:7610634:-1 gene:ENSGGOG00000000630 transcript:ENSGGOT00000026452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRCLSFLLMGTFLSVSQTVLAQPDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYG
FSP
Download sequence
Identical sequences G3SDJ0
XP_004063198.1.27298 ENSGGOP00000026170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]