SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026293
Domain Number 1 Region: 267-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000139
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 
Domain Number 2 Region: 172-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000483
Family I set domains 0.081
Further Details:      
 
Domain Number 3 Region: 30-77,108-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000544
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026293   Gene: ENSGGOG00000003225   Transcript: ENSGGOT00000024183
Sequence length 531
Comment pep:known_by_projection chromosome:gorGor3.1:12:6970457:6976425:1 gene:ENSGGOG00000003225 transcript:ENSGGOT00000024183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG
VTWQHQPDSGPPAPAPGHPLVPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV
QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPSGSLR
TSDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG
CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPAGVGTRSFLTAKWTP
PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIRLQEQQLNATVTLAIITVTPKSFGS
PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEVQLLSQPWQCQLYQGERL
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLTLGVLSLLLLVTGAFGFHLWRRQWRP
RRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPELGPEPEPEPEPEQL
Download sequence
Identical sequences XP_004052634.1.27298 ENSGGOP00000026293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]