SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026382 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026382
Domain Number 1 Region: 600-806
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-31
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 809-994
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-25
Family Fibronectin type III 0.000023
Further Details:      
 
Domain Number 3 Region: 318-407
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-19
Family I set domains 0.00085
Further Details:      
 
Domain Number 4 Region: 420-501
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 227-313
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-17
Family I set domains 0.002
Further Details:      
 
Domain Number 6 Region: 506-607
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-17
Family I set domains 0.046
Further Details:      
 
Domain Number 7 Region: 124-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000627
Family I set domains 0.00042
Further Details:      
 
Domain Number 8 Region: 27-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000226
Family I set domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026382   Gene: ENSGGOG00000002403   Transcript: ENSGGOT00000024067
Sequence length 1032
Comment pep:known_by_projection chromosome:gorGor3.1:3:1256764:1442391:1 gene:ENSGGOG00000002403 transcript:ENSGGOT00000024067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLILLVLGVLCPLFVSNIKGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANSYPSPH
YRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFA
YIEDFETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETG
NLYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQA
AKDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIA
SNLRGRNLAKGQLIFYETAPPEWEQKIQNTYLSIYDNLLWECKASGKPNPWYTWLKNGER
LNPEERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKK
KSFVQVGGDIVIGCKPNAFPRAAISWKRGTETLRQSKRIFLLEDGSLKIYNITRSDAGSY
TCIATNQFGTAKNTGSLIVKAERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWF
FNGDVIDLKKGVAHFERIGGESVGDLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRG
PPGPPEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGK
TYNATVVGLSPWVEYEFRVVAGNSIGIGEPSKPSELLRTKASVPVVAPVNIHGGGGSRSE
LVITWESIPEELQNGDGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIPLSPFEV
KVGVYNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVL
GYEVLYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNV
TTKKSPPSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETN
NTSAELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMSSLSSRGIQFLEPSTHFLSIVI
VIFYCFAIQPLI
Download sequence
Identical sequences ENSGGOP00000026382 ENSGGOP00000026382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]