SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026484 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026484
Domain Number 1 Region: 23-113
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-22
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026484   Gene: ENSGGOG00000024768   Transcript: ENSGGOT00000026611
Sequence length 116
Comment pep:novel chromosome:gorGor3.1:7:140886468:140886914:1 gene:ENSGGOG00000024768 transcript:ENSGGOT00000026611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWTLCVSLCILVATCTDPGIIQSPKHEVTEMGQTVTLRCEPIFGHNLLFWYRETFVQG
LELLSYFRSRSIIDNAGMPTDRFSAERPDGSFSTLKIQPAEQGDSAVYVCASRLAT
Download sequence
Identical sequences ENSGGOP00000026484 ENSGGOP00000026484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]