SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026492 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026492
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily ITPase-like 2.55e-37
Family Maf-like 0.0000632
Further Details:      
 
Domain Number 2 Region: 316-508
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.84e-25
Family Plant O-methyltransferase, C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 234-309
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000129
Family Plant O-methyltransferase, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026492   Gene: ENSGGOG00000022304   Transcript: ENSGGOT00000026330
Sequence length 519
Comment pep:known_by_projection chromosome:gorGor3.1:X:1270006:1312126:-1 gene:ENSGGOG00000022304 transcript:ENSGGOT00000026330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLRFEVVPSKFKEKLDKASFATPYGYAMETAKQKALEVANRMHQKDLRAPDVVIGADTIV
TVGGLILEKPVDKQDAYRMLSHQLDTTVSEFYEETKVKFSELSEELLWEYVHSGEPMDKA
GGYGIQALGGMLVESIHGDFLNVVGFPLNHFCKQLVKLYYPPRPEDLRRSVKHDSIPAAD
TFEDLSDVEGGGSEPAQRDASSRDEKAEAGEAGQAAAEAECHRTRETLPPFPTRLLELIE
GFMLSKALFTACKLKVFDLLKDEAPQKAVDIASKVDASACGTERLLDICAAMGLLEKTEQ
GYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKVEDL
FQDAYYQSPETRLRFMRAMHGMTKLTACQVATAFNLSHFSSACDVGGCTGALARELAREY
PRMQVTVFDLPDIIELAAHFQPAGLLLVETLLVETLLDEEKRVAQRTLMQSLNMLVQTEG
KKRSLGEYQCLLEVHGFHQVQVVHLGGVLDAILATKVAP
Download sequence
Identical sequences ENSGGOP00000026492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]