SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026526 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026526
Domain Number 1 Region: 19-275
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.01e-79
Family Carbonic anhydrase 0.00000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026526   Gene: ENSGGOG00000007520   Transcript: ENSGGOT00000032783
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:1:9102391:9130809:1 gene:ENSGGOG00000007520 transcript:ENSGGOT00000032783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLLLSLFLLGGQAQHGSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPAL
KGLNLTGYETQAGEFPMVNNGHTVQISLPSTMRMTAADGTVYIAQQMHFHWGGASSEISG
SEHTVDGIRHVIEIHVVHYNSKYKSYDIAQDAPDGLAVLAAFVEVSRNYPWAIFISFIDH
KEEVNWSGQRTTLTGLDIQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRMQ
VWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLRKIEEILEYL
RRAL
Download sequence
Identical sequences ENSGGOP00000026526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]