SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026608 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026608
Domain Number 1 Region: 29-518
Classification Level Classification E-value
Superfamily Sema domain 5.36e-183
Family Sema domain 0.0000000000109
Further Details:      
 
Domain Number 2 Region: 515-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000419
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 580-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000224
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026608   Gene: ENSGGOG00000007053   Transcript: ENSGGOT00000022826
Sequence length 749
Comment pep:known_by_projection chromosome:gorGor3.1:3:51569735:51579263:1 gene:ENSGGOG00000007053 transcript:ENSGGOT00000022826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYEALLV
DEERGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNSTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRSASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRETAVETAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEG
PMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPIGGRPL
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDAGTVLKVISVPKGSRPSAEGLLLEELH
VFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVA
CTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQAR
VEWTFQRAGVTAHTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQPLRRLSL
HVLSATQAERLARAEEAAPVAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPPLQSLP
VESRRKGRNRRTHAPEPRAERGPRSATHW
Download sequence
Identical sequences G3SES4
ENSGGOP00000006905 ENSGGOP00000026608 XP_004034225.1.27298 XP_018878762.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]