SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026807 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000026807
Domain Number - Region: 1-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0435
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026807   Gene: ENSGGOG00000024228   Transcript: ENSGGOT00000032322
Sequence length 133
Comment pep:novel chromosome:gorGor3.1:19:48852980:48853599:1 gene:ENSGGOG00000024228 transcript:ENSGGOT00000032322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHVPCSFCYPQDSWTDSDPLHSYWLGEVALPASDAPVATNNPDRKVQVDTQGQLQLSRDR
QINDCSLGSYFFHVEGGNMKWRYKINRLSMHVMRPTHRPDIFIPITLESAPSITCSVPWA
CEQGMPPTITWMG
Download sequence
Identical sequences ENSGGOP00000026807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]