SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026840 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026840
Domain Number 1 Region: 684-797
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000655
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 2 Region: 134-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000672
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 3 Region: 7-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000725
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Domain Number 4 Region: 559-651
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000119
Family C1 set domains (antibody constant domain-like) 0.074
Further Details:      
 
Domain Number 5 Region: 424-520
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000145
Family I set domains 0.075
Further Details:      
 
Domain Number 6 Region: 276-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000256
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026840   Gene: ENSGGOG00000025555   Transcript: ENSGGOT00000027153
Sequence length 816
Comment pep:known_by_projection chromosome:gorGor3.1:2a:91451223:91514694:1 gene:ENSGGOG00000025555 transcript:ENSGGOT00000027153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIYLPSSPEREVQIVSTM
DSSFPYAIYTQRICEGKIFIERVQGNPTLLHITDLQAQDAGEYECHTPSTDKQYFGIYSA
KMNLVMIPDSLRTTAMPQTLHRVEQDPLELTCEVASETVQHSHLSVAWLWQKVGEKPVEV
ISLSRDFMLHSGSEYAQRQSLGEVLLDKLGRTTFRLTIFHLQPSDQGEFYCEAAEWIQDP
DGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEFRCILEAQNVPDRYFA
VSWAFNSSLIATIGPNAVRVLNSEFAHREARGQLNVAKESDSVFVLKIYHLRQEDRGKYN
CRVTEREKTVTGEFIDKESKRPKNIPIVLPLADNWVVKIPHHQMLSQGHLESSISVEVAS
NASVILEGKDLRFSCSVRMAGRLQGRFSVIWQLVDRQNRRSNIMWLDRHGTVQPGLSYWK
RSSFGSVQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRVVDGEWQIVGERRASTPIS
IIALEMGFAVTAISRAPGVTYSDSFDLQCIIKPHYPAQVPVSVTWWFQPVGTVEFHDLVT
FTRDGGVQWGNRSSSFQTRTATEKAEPSNNVRLSISRASDTEAGKYQCVAELWRKNYNNT
WTRLAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLW
YVHKPSDANGKLILKTAHNSAFEYGTYAEEEGLRARLQFERPVSGSLFSLTVQRAEVSDS
GSYYCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQP
Download sequence
Identical sequences ENSGGOP00000026840 ENSGGOP00000026840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]