SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026863 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026863
Domain Number 1 Region: 191-301
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000255
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 2 Region: 361-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000149
Family C1 set domains (antibody constant domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026863   Gene: ENSGGOG00000004655   Transcript: ENSGGOT00000024814
Sequence length 471
Comment pep:known_by_projection chromosome:gorGor3.1:12:6641460:6650555:1 gene:ENSGGOG00000004655 transcript:ENSGGOT00000024814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVNVVLDCFLAKDGAHRGALASSEDRARA
SLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEV
TCEISRYFLQMTETTVKTAAWFMANVQVSGGGPSISLVMKTPRVAKNEALWHPTLNLPLS
PQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYS
WTAGQGQAVRKGATLELEQLGMARDASLTLPSLTIQDEGTYICQITTSLYRAQQIIQLNI
QGEDNPTKRFPAQDPAALLWLAVSITPVLLDHILRSSSSKPRQSSGSSSDHYHCYPLKSL
GVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLF
LLALMFLGLQRRQAPTRLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS
Download sequence
Identical sequences ENSGGOP00000026863 ENSGGOP00000026863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]