SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026868 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026868
Domain Number 1 Region: 1108-1420
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.25e-113
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000119
Further Details:      
 
Domain Number 2 Region: 1384-1658
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000208
Further Details:      
 
Domain Number 3 Region: 331-525
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-44
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 4 Region: 523-718
Classification Level Classification E-value
Superfamily Fibronectin type III 6.62e-43
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 5 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 6 Region: 720-831
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-17
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 7 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 8 Region: 243-337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000167
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026868   Gene: ENSGGOG00000008094   Transcript: ENSGGOT00000023205
Sequence length 1658
Comment pep:known_by_projection chromosome:gorGor3.1:19:5316115:5396057:-1 gene:ENSGGOG00000008094 transcript:ENSGGOT00000023205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREV
RRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLEL
TDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPV
SYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTR
TGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV
DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETS
ITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQ
GLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP
LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDWE
TDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVSPKNFKVKMIMKT
SVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFVLTNRGSSLGG
LQQTVTAWTAFNLLNGKPSVAPKPDADGFIMVYLPDGQSPVPVQSYFIVMVPLRKSRGGQ
FLTPLGSPEDMDLEELIQDISRLQRRSLRHSRQLEVPRPYIAARFSVLPPTFHPGDQKQY
GGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIWVIG
PVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQT
PDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTW
EHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIVGSDYINANYVDGYRRQNAYIATQGPL
PETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELAT
FCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVH
CSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEA
VGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFK
NRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRML
WENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDA
RDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTG
VFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTE
Download sequence
Identical sequences ENSGGOP00000026868 ENSGGOP00000026868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]