SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026911 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026911
Domain Number 1 Region: 242-489
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-85
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.072
Further Details:      
 
Domain Number 3 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026911
Domain Number - Region: 5-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026911   Gene: ENSGGOG00000004836   Transcript: ENSGGOT00000029405
Sequence length 492
Comment pep:known_by_projection chromosome:gorGor3.1:21:30090513:30133984:-1 gene:ENSGGOG00000004836 transcript:ENSGGOT00000029405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVAPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVRTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSDSGIEC
DSSGTCISPSNWCDGVSHCPSGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGVSALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYEAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLEPEQLCWISGWGATEEKGKTSEVLNAARVLLIETQKCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTLKNNVWWLIGDTSWGSGCAKAYRPGVYGNVTVF
TDWIYRQMRADG
Download sequence
Identical sequences G3SFM5
XP_004062887.1.27298 ENSGGOP00000026911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]