SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026924 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026924
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily POZ domain 3.65e-23
Family BTB/POZ domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026924   Gene: ENSGGOG00000024356   Transcript: ENSGGOT00000022048
Sequence length 291
Comment pep:known_by_projection chromosome:gorGor3.1:1:46343629:46349347:1 gene:ENSGGOG00000024356 transcript:ENSGGOT00000022048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLGLVVHGKAEPFSAALRSLVNNPRYSDVCFVVGQERQEVFAHRCLLACRCNFFQRLL
GTEPGPGVPSPVVLSTVPTEAFLAVLEFLYTNSVKLHRHSVLEVLTAAVEYGLEELRELC
LQFVVKVLDVELVCEALQVAVTFGLGQLQERCVAFIEAHSQEALRTRGFLELSAAALLPL
LRSDKLCVDEAELVRAARSWARVGAAVLERPVAEVAAPVVKELRLALLAPAELSALEEQN
RQEPLIPVEQIVEAWKCHALRRGDEARGAACRRRRGTLPREHHRFLDLSFK
Download sequence
Identical sequences G3SFN8
ENSGGOP00000026924 ENSGGOP00000026924 XP_018872888.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]