SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026925 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026925
Domain Number 1 Region: 218-311
Classification Level Classification E-value
Superfamily Immunoglobulin 2.03e-20
Family C1 set domains (antibody constant domain-like) 0.00000524
Further Details:      
 
Domain Number 2 Region: 320-418
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-20
Family C1 set domains (antibody constant domain-like) 0.00000386
Further Details:      
 
Domain Number 3 Region: 110-199
Classification Level Classification E-value
Superfamily Immunoglobulin 6.37e-18
Family C1 set domains (antibody constant domain-like) 0.0000108
Further Details:      
 
Domain Number 4 Region: 6-101
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-17
Family C1 set domains (antibody constant domain-like) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026925   Gene: ENSGGOG00000028496   Transcript: ENSGGOT00000032521
Sequence length 438
Comment pep:known_by_projection chromosome:gorGor3.1:14:87676296:87679063:-1 gene:ENSGGOG00000028496 transcript:ENSGGOT00000032521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDAGSLNGTTMTLPATTL
TPSGHYATISLLTVSGAWAKQMFTCHVAHTPSSADWVDNKTFGVCSRDFTPPTVKILQSS
CDGGGHLPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTL
SQKHWLSDRTYTCQVTYQGDTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCL
VVDLAPSKGTVNLTWSRASGKPVNHSTRKQEKQRNGTLTVTSTLPVGTRDWIEGETYQCR
VTHPHLPRALVRSTTKTSGPRAAPEVYAFATPEGPGSRDKRTLACLIQNFMPEDISVQWL
HNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR
AVSVNPVQPSLSPCQQHP
Download sequence
Identical sequences ENSGGOP00000026925 ENSGGOP00000026925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]