SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026986 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026986
Domain Number 1 Region: 249-337
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-19
Family C1 set domains (antibody constant domain-like) 0.0085
Further Details:      
 
Domain Number 2 Region: 34-150
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-16
Family V set domains (antibody variable domain-like) 0.0097
Further Details:      
 
Domain Number 3 Region: 145-236
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-16
Family C1 set domains (antibody constant domain-like) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026986   Gene: ENSGGOG00000005571   Transcript: ENSGGOT00000030364
Sequence length 398
Comment pep:known_by_projection chromosome:gorGor3.1:20:1580619:1641174:-1 gene:ENSGGOG00000005571 transcript:ENSGGOT00000030364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPASWPHLPSPFLLMTLLLGGLTGVAGEEELQVIQPDKSISVAAGESATLHCNVTSLI
PVGPIQWFRGAGPGRELIYNKKEGHFPRVTTVSDPTKRNNMDFSIRISNITPADAGTYYC
VKFWKGSPYDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT
LKWFKNGNEISDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEMAHVTLQGDPLR
GTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQLTWLENGNVSRTETAST
LIENKDGTYNWISWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDIT
HEPALAPTTPLLVALLLGPKLLLVVGVSAVYICWKQKA
Download sequence
Identical sequences ENSGGOP00000026986 ENSGGOP00000017050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]