SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027096 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027096
Domain Number 1 Region: 109-217
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 2 Region: 61-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000485
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000298
Family Growth factor receptor domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027096   Gene: ENSGGOG00000024287   Transcript: ENSGGOT00000027754
Sequence length 232
Comment pep:known_by_projection chromosome:gorGor3.1:9:39258641:39272237:-1 gene:ENSGGOG00000024287 transcript:ENSGGOT00000027754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGPCRPEGCPAPAPCPAPGISALDECGCCARRLGAEGASCGPGLVCASRAAGAAPEGTGL
CVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVH
NVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEAT
AWILINPLRKEDEGMYQCHAANMVGEAESHSTVMVLDCVHEVNWEFGKGITL
Download sequence
Identical sequences ENSGGOP00000027096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]