SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027226 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027226
Domain Number 1 Region: 2478-2667
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.88e-87
Family BRCA2 helical domain 0.0000000329
Further Details:      
 
Domain Number 2 Region: 2950-3082
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-54
Family Single strand DNA-binding domain, SSB 0.00000579
Further Details:      
 
Domain Number 3 Region: 2668-2778
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-35
Family Single strand DNA-binding domain, SSB 0.00000343
Further Details:      
 
Domain Number 4 Region: 2776-2865
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.61e-33
Family BRCA2 tower domain 0.0000307
Further Details:      
 
Domain Number 5 Region: 2867-2949
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.22e-23
Family Single strand DNA-binding domain, SSB 0.0000393
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027226
Domain Number - Region: 1674-1760
Classification Level Classification E-value
Superfamily AbfB domain 0.0575
Family AbfB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027226   Gene: ENSGGOG00000015808   Transcript: ENSGGOT00000011464
Sequence length 3315
Comment pep:known_by_projection chromosome:gorGor3.1:13:14169243:14261094:1 gene:ENSGGOG00000015808 transcript:ENSGGOT00000011464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPN
LFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTV
KTKMDQADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHI
SESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESL
KKNDRFIASVTDSENTNQREATSHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV
DTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKISHEANADECEKSKNQVKEKYSFVSEVEP
NDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLNISSCD
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDC
ILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFGASFSGHMTDPNFKKETEASESGL
EIHTVCSQKEDSLCPNLIDNGSWPATTTQTSVALKNAGLISTLKKKTNKFIYAIHDETSY
KGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLT
SSFGTILRKCSRNETCSNDTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCEND
PKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLS
NLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNPTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVK
QHIKMTLGQDLKSDISLNIDKIPDKNNDYMDKWAGLLGPISNHSFGGSFRTASNKEIKLS
EHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSD
CKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKS
TFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQLDSSKQFEGTVEIKRKFAGLLKNDC
NKSASGYLTDENEVGFRGFYSAHGAKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL
SSSKCHDSVVSMFKIENHNDKTVSEKNKCQLILQNNIEMTTGTFVEEITENYKRNTENED
NKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIK
EDLSDLTFLEVVKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKE
SFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGN
QLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSH
QWAKTLKYREACKDLELACETIEITTAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLC
RQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSV
SQTSLREAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLS
NSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYP
QTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKK
VKDMFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKVF
ADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSTNTCGIFSTA
SGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLIS
QKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQN
VSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQD
KQQLVLGTKVSLVENIHVLGKEQASPENVKMEIGKTEAFSDVPVKTNIEVCSTYSKDSEN
YFETEAVEIAKAFMEDDELTDSELPSHATHSLFTCPENEEMVLSNSRTGKRRGEPLILVG
EPSIKRNLLNEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKEH
QEIQNPNFTAPGQEFLSESHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTGR
PTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQFNKNN
SNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRI
SLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQL
ADGGWLIPSSDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKE
FANRCLSPERVLLQLKYRYDMEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANIS
ETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGS
PDACTPLEAPESLMLKNTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPANLEGYFS
EEQLRALNNHRQMLNDKKQAQIQLEVRKAMESAEQKEKGLSRDVTTVWKLRIVSYSKKEK
DSVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSD
EILFQVYQPREPLHFSKFLDPDFQPSCSEVDLIGFVISVVKKTGLAPFVYLSDECYNLLA
IKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLPTLFAGDFSVFSASPKEGHFQETFNKM
KNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSPNC
EIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPP
VSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADE
ELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTSLIKEQESSQASTEE
CEKNKQDTITTKKYI
Download sequence
Identical sequences ENSGGOP00000027226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]