SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027233 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027233
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.88e-82
Family MHC antigen-recognition domain 0.000000033
Further Details:      
 
Domain Number 2 Region: 210-300
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-30
Family C1 set domains (antibody constant domain-like) 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027233   Gene: ENSGGOG00000005772   Transcript: ENSGGOT00000022877
Sequence length 365
Comment pep:known_by_projection chromosome:gorGor3.1:6:30871632:30967560:1 gene:ENSGGOG00000005772 transcript:ENSGGOT00000022877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWMEQEEPEYWDRQTQISKTNAQIELESLRIALRYYNQSEDGSHTIQ
RMYGCDVGSDGRFLRGYQQDAYDGKDYIASNEDLRSWTAADMAAEITKRKWEAAHFAEQL
RAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHPVSDHEAILRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPIVGIIAGLVLFGAVIAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDVSL
TACKV
Download sequence
Identical sequences G3SGJ7
ENSGGOP00000027233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]