SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027444
Domain Number 1 Region: 11-84
Classification Level Classification E-value
Superfamily dUTPase-like 0.00000000000000236
Family dUTPase-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027444   Gene: ENSGGOG00000028440   Transcript: ENSGGOT00000033109
Sequence length 140
Comment pep:novel chromosome:gorGor3.1:9:26609847:26625246:1 gene:ENSGGOG00000028440 transcript:ENSGGOT00000033109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVIPALWEAKGEVLPPGDTTTIPLNWMLKSPPGHLGLLLLLSQQAKNGVMVLAGVTDPE
YQDEISLLLHNEGHLKDVKMEGARLGLPGRAESLEHQVQSHLNMIAQSQRTFQKKDAGKA
IILSKLTQEQKTKHCMFSLY
Download sequence
Identical sequences ENSGGOP00000027444 ENSGGOP00000027444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]