SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027471 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027471
Domain Number 1 Region: 396-510,632-778
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-65
Family Phosphate binding protein-like 0.00000000127
Further Details:      
 
Domain Number 2 Region: 3-384
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.79e-62
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027471
Domain Number - Region: 525-629
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00133
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027471   Gene: ENSGGOG00000017011   Transcript: ENSGGOT00000033603
Sequence length 885
Comment pep:known_by_projection chromosome:gorGor3.1:11:103225661:103621582:1 gene:ENSGGOG00000017011 transcript:ENSGGOT00000033603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAV
TNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLR
GALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLE
ELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANV
TGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRKQK
IDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFEL
KSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEG
NDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIA
PLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVS
VVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRFRS
LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGST
KEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQR
KPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGS
GGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRN
KARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
Download sequence
Identical sequences ENSGGOP00000027471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]