SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027474 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027474
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily POZ domain 3.09e-27
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 605-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000952
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 374-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000223
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 502-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000388
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 5 Region: 467-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000243
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 642-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000028
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027474   Gene: ENSGGOG00000024480   Transcript: ENSGGOT00000031273
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:12:55114823:55116961:-1 gene:ENSGGOG00000024480 transcript:ENSGGOT00000031273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMRIKLQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFL
NTGLDAARTYVVDFITPANFEKVLSFVYTSELFTDLINVGVIYEVAERLGMEDLLQACHS
TFPDLESTARAKTLTSTSESHSGTLSCPSAEPAHPLGELRGGGDHLGADRNYVLPSDAGG
SYKEEEKNIASDANHSLHLPQPPPPPPKTEDHDTPAPFTSIPSMMTQPVLGTVSTGIQTS
TSSCQPYKVQSNGDFSKNSFLTPDNAVDITTGTNSCLSNSEHSKDPGFGQMDELQLEDLG
DDDLQFEDPAEDIGTTEEVIELSDDSEDELTFGENDNRENKAMPCQVCKKVLEPNIQLIR
QHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTLHRR
DGIFENNIIVHPNDPLPGKLGLFSGAASPELKCAACGKVLAKDFHVVRGHILDHLNLKGQ
ACSVCDQRHLNLCSLMWHTLSHLGISVFSCSVCANSFVDWHLLEKHMAVHQSLEDALFHC
RLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEFLSEELALQGQP
GNSKYSCKVCGKRFAHTSEFNYHRRIHTGEKPYQCKVCHKFFRGRSTIKCHLKTHSGALM
YRCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIEQTFMYIIHSKEADKNPDS
Download sequence
Identical sequences G3SH86
XP_018893633.1.27298 ENSGGOP00000027474 ENSGGOP00000027474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]