SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027475 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027475
Domain Number 1 Region: 88-200
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.00000000000000249
Family Ribosome-binding factor A, RbfA 0.00000313
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027475
Domain Number - Region: 271-328
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0889
Family eIF-2-alpha, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027475   Gene: ENSGGOG00000003131   Transcript: ENSGGOT00000022481
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:18:78561030:78572333:1 gene:ENSGGOG00000003131 transcript:ENSGGOT00000022481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAAAGGLWRSRAGLRALFPSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYES
PSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDL
NVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRLFVQISQVALRKVKAI
AAFMQMKSNETLTRLDQLLAVADFGPRDERDNFVRNDFRDPDAPQPCGITEPATSSSLCG
IDHEALNKQIMEYKRRKDKGLRGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSG
EEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGATRE
Download sequence
Identical sequences ENSGGOP00000027475 ENSGGOP00000003079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]