SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027543 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027543
Domain Number 1 Region: 39-176
Classification Level Classification E-value
Superfamily L domain-like 1.26e-33
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 197-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000511
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027543   Gene: ENSGGOG00000026260   Transcript: ENSGGOT00000022244
Sequence length 317
Comment pep:novel chromosome:gorGor3.1:18:12287775:12289080:-1 gene:ENSGGOG00000026260 transcript:ENSGGOT00000022244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKHDGRPRGAGRAAGAAEGKVVCSILELAQVLPPDTLPNRTVTLILSNNKISELQNGSFS
GLSLLERLDLNNLISRIDPGAFWGLSSLKRLDLTNNRIGCLNANIFRGLTNLARLNLSGN
LFSSLSQGTFDYLASLRSLEFQTEYLLCDCNLLWMHRWVKERNITVRDTRCVYPKSLQAQ
PVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLRYQDGRI
VETDESQGTFVEKNMIHNCSLIASALTVSNNQAGSTGNWGCHVQTKRGNNTRTVDIVVLE
SSAQYCPPERVIYQRGK
Download sequence
Identical sequences ENSGGOP00000027543 ENSGGOP00000027543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]