SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027574 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027574
Domain Number 1 Region: 1387-1526
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.41e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000221
Further Details:      
 
Domain Number 2 Region: 183-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000588
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027574   Gene: ENSGGOG00000000387   Transcript: ENSGGOT00000026937
Sequence length 1531
Comment pep:known_by_projection chromosome:gorGor3.1:9:119473267:119548806:-1 gene:ENSGGOG00000000387 transcript:ENSGGOT00000026937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDNIPEDLRDPFYVDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQ
ALSRKGIYVMESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRF
STFSASKELPYDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHLSA
RQSPYFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREF
SNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTV
LHQKSSRPPVPISNATKRSFLGSPAAGTPADLQPPMQLPAEGCHRHYLHPEEPEYLGKGT
AAFSPSHPLLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQP
TPFALHHAASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTATKSHGKSLLSN
VSIEDEEEELVAIVRADVVPQHADPEFPRASPRALGLTANARSPQGQLDTSESKPDSFFL
EPLMPAVLKPAKEKQVITKEDERGEGRPRSIVSRRPSEGPQPLVRRKMTGSLGIDPTETG
PQSVETAGEVCGGPLALGGFDLFAQGPSTDGFFLHVGRADEDTEGRLYVSCSKSPNSHDS
EPWTLLRQDSDSDVVDIDEAEHDFMGEVHPVVLSRYIGEEESAKLQEDMKVKEHEDKDDA
SGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPDASESC
PAPLTTWRQKREQSPSQHGRDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRL
KLGKAAFLHVVKKGKAEAAPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLVKEEQREELL
HEPQDVDKESLAFAQQHKAKDPVALHELERNKVLSAALLEDAVGEVVDVNECDLSIEKLN
ETISTLQQAILKISQQQEQLLMKSPTVPVPGSKNNSQEHKVKAPVHFVEPLSPTGVAGHR
KAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASSHPRTPTDP
GLDGALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEV
GPSSSDVSGKESVPVEEPLRSRASLIEVDLSDLKAPDEDGELASLDGSADLVSEGDQKPG
VGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRV
RKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDSGTKCSS
TPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRMEALPILSRNPSRSTDRDWETASA
ASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANH
YIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNLIPAK
TMSVSVDALTIHNHLWQPKRPAVPKKAQTRK
Download sequence
Identical sequences ENSGGOP00000027574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]