SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027620
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily POZ domain 5.02e-31
Family BTB/POZ domain 0.00042
Further Details:      
 
Domain Number 2 Region: 495-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 536-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000361
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 568-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000737
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 289-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000773
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 401-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000188
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 700-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000871
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027620   Gene: ENSGGOG00000012058   Transcript: ENSGGOT00000032975
Sequence length 787
Comment pep:known_by_projection chromosome:gorGor3.1:1:16433454:16467576:-1 gene:ENSGGOG00000012058 transcript:ENSGGOT00000032975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKAATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPAGAGPAEVKEEGSQ
LGNGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFT
HTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISL
LNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRH
LETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIH
SGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEK
PYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLC
DKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVT
QLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHV
RIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAP
ECPPPAE
Download sequence
Identical sequences ENSGGOP00000027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]