SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027716 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027716
Domain Number 1 Region: 5-45
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000124
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027716   Gene: ENSGGOG00000023122   Transcript: ENSGGOT00000031803
Sequence length 45
Comment pep:novel chromosome:gorGor3.1:16:32643483:32643617:1 gene:ENSGGOG00000023122 transcript:ENSGGOT00000031803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHFLVQLGQSEAEVKKPEASVKVSCKASGYTFTYCYLHWVRWAPG
Download sequence
Identical sequences ENSGGOP00000027716 ENSGGOP00000027716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]