SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027742 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027742
Domain Number 1 Region: 14-103
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-34
Family V set domains (antibody variable domain-like) 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027742   Gene: ENSGGOG00000025486   Transcript: ENSGGOT00000030260
Sequence length 116
Comment pep:known_by_projection chromosome:gorGor3.1:22:6480778:6481125:1 gene:ENSGGOG00000025486 transcript:ENSGGOT00000030260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFFLAGSEASYELTQPPSVSVSLGQTARITCSGEELPKKYAYWYQQKPGQSPVLVIYKD
SERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSDTYPTVTQADREV
Download sequence
Identical sequences ENSGGOP00000027742 ENSGGOP00000027742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]