SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027783 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027783
Domain Number 1 Region: 519-617
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-26
Family I set domains 0.00043
Further Details:      
 
Domain Number 2 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 7.12e-26
Family I set domains 0.0000353
Further Details:      
 
Domain Number 3 Region: 120-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-24
Family I set domains 0.00000841
Further Details:      
 
Domain Number 4 Region: 223-313
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-23
Family I set domains 0.00026
Further Details:      
 
Domain Number 5 Region: 318-417
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.00026
Further Details:      
 
Domain Number 6 Region: 420-516
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-22
Family I set domains 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027783   Gene: ENSGGOG00000013781   Transcript: ENSGGOT00000033242
Sequence length 617
Comment pep:known_by_projection chromosome:gorGor3.1:19:52051931:52060305:1 gene:ENSGGOG00000013781 transcript:ENSGGOT00000033242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTVLICLGLSLGPRTHVQAGILPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHL
YRENKSASWVRRIQEPGKKGQFPIPSITWEHAGRYRCQYHSHNHSSEYSDPLELVVTGAY
SKPTLSALPSPVVTSGGNVTLQCGSQVAFDSFILCKEGEDEHPQRLNSQSHARGWSWAVF
SVGPVSPSRRWSYRCYAYDSSSPYVWSLPSDLLELLVPENLLKPILWAEPGPVITWNNPV
TIWCQGTLEAQGYRLDKEGNSMSRHILKTLESENKVKFSIPSMMWEHAGRYHCYYQSPAG
WSDPSDPLELVVTVLKAYSRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRL
SWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENKTPYVWSEPSDPLQLLVSGVSR
KPSLLTLQGPVVIPGDNLTLQCGSDVSYIRYTLYKEGADGLAQRPGRQPQAGLSQANFTL
SPVSRSYGGQYRCYGAHNVSSKWSAPSDPLDILIAGQIPDRPSLSVQPGPTVASGEKVTL
LCQSQGGMHTFLLTKEGAADSPLRLKSKHQSHKYQAEFPVSPVTSAHVGTYRCYSSLSSN
PYLLSLPSEPLELVVSG
Download sequence
Identical sequences ENSGGOP00000027783 ENSGGOP00000013459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]