SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027797 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027797
Domain Number 1 Region: 308-587
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-79
Family Kelch motif 0.000000976
Further Details:      
 
Domain Number 2 Region: 35-151
Classification Level Classification E-value
Superfamily POZ domain 4.94e-24
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027797   Gene: ENSGGOG00000001786   Transcript: ENSGGOT00000034516
Sequence length 593
Comment pep:known_by_projection chromosome:gorGor3.1:4:175690569:175791206:1 gene:ENSGGOG00000001786 transcript:ENSGGOT00000034516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDGTLTPGRCTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTI
VAEDMEISAHRVVLAACSPYFHAMFTVKIMPKNKKVVVIRVDDKWNLQIQVDRSYIARIS
IFKTNFKVLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTY
AEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMAR
LMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMKYHLLPTEQRILMKSVRTRLR
TPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGG
FNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWTYIA
EMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCA
VNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL
Download sequence
Identical sequences ENSGGOP00000027797 ENSGGOP00000027797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]