SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027807 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027807
Domain Number 1 Region: 765-1058
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000206
Further Details:      
 
Domain Number 2 Region: 2-257
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-76
Family Carbonic anhydrase 0.0000104
Further Details:      
 
Domain Number 3 Region: 1062-1348
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.95e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 285-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000675
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027807   Gene: ENSGGOG00000006858   Transcript: ENSGGOT00000028609
Sequence length 1383
Comment pep:known_by_projection chromosome:gorGor3.1:3:63538472:63811295:1 gene:ENSGGOG00000006858 transcript:ENSGGOT00000028609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGAYGPEHWVTSSVSCGGHHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGK
TVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPD
DFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRDLL
PASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYL
RNNFRPQQRLHDRVVSKSAVRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQTA
LQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYLFR
VQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTS
SGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAA
SASKQAARPVLATTEALASPGPDGDSSPTKDSEGTEEGEKDEKSESEDGEREHEEDGEKD
SEKKEKSGVTHAAEEQNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRRDA
GPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAEKN
TSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREVPS
SGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGELYS
NNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSK
HSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCD
QYWPTENSEEYGNIIVTLKSTKIHACYTVRCFSIRNTKMKKGQKGNPKGRQNERVVIQYH
YTQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKD
KSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSILIP
GVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKG
TDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVY
WPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNP
DAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQV
AKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESME
SLV
Download sequence
Identical sequences ENSGGOP00000027807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]