SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027883 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027883
Domain Number 1 Region: 42-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000761
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 
Domain Number 2 Region: 140-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000957
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027883   Gene: ENSGGOG00000005365   Transcript: ENSGGOT00000029899
Sequence length 314
Comment pep:known_by_projection chromosome:gorGor3.1:3:112224263:112285972:-1 gene:ENSGGOG00000005365 transcript:ENSGGOT00000029899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLII
ITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRPVAITHDGYYR
CIMVTPDGNFHRGYHLQVLVTPEVTLFRNRNRTAVCKAVAGKPAAQISWIPEGDCATKQE
YWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILT
IIILTIVGFIWLLKVNGCSFIRLEKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKAS
QALQSEVGTDLHTL
Download sequence
Identical sequences ENSGGOP00000027883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]