SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027914 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027914
Domain Number 1 Region: 128-383
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-71
Family Extended AAA-ATPase domain 0.00000131
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027914
Domain Number - Region: 43-72
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000745
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027914   Gene: ENSGGOG00000006803   Transcript: ENSGGOT00000034443
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:5:19910129:19914697:-1 gene:ENSGGOG00000006803 transcript:ENSGGOT00000034443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REKMALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVR
LLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALR
NDSYEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGK
TLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGS
SRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIE
FPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRV
HVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Download sequence
Identical sequences ENSGGOP00000027914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]