SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028097 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028097
Domain Number 1 Region: 948-1034
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-19
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 251-352
Classification Level Classification E-value
Superfamily Immunoglobulin 9.75e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 869-956
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 351-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 
Domain Number 5 Region: 654-754
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000833
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 46-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000238
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 556-658
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000587
Family I set domains 0.058
Further Details:      
 
Domain Number 8 Region: 146-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000969
Family C1 set domains (antibody constant domain-like) 0.058
Further Details:      
 
Domain Number 9 Region: 748-850
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000299
Family I set domains 0.017
Further Details:      
 
Domain Number 10 Region: 456-559
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000314
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028097   Gene: ENSGGOG00000012741   Transcript: ENSGGOT00000030796
Sequence length 1250
Comment pep:known_by_projection chromosome:gorGor3.1:19:33126322:33151838:-1 gene:ENSGGOG00000012741 transcript:ENSGGOT00000030796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAGGVTVGGPVMALGTTLRASLLLLGLLTEGLAQLAIPASVPRGFWALPENLTVVEGAS
VELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAE
YECQVGRSETGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVSCVSGDAKPA
PDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPI
KASFTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTA
WGTEHTQAVARSVLVMTVRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGS
ASQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEETVMDGLHGGHISMSNLTFLARR
EDNGLTLTCEAFSEAFTKETFKKSLILNVKYPAQKLWIEGPPEGQKLRAGTRVRLVCLAI
GGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTC
KAGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLE
GVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEF
LGEQVLVVTAVEQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWN
VTRADDGLYQLHCQNSEGTAEALLRLDVHYAPTIRALQDPTEVNVGGSVDIVCTVDANPI
LPGMFSWERLGEDEEDQSLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARR
LVRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGIPLDLQDPR
YTEHIYHQGGVHSSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLK
VVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALGTPGFHYVDVLPPQATTFTLTGLQPSTR
YRVWLLASNALGDSGLADKGTQLPITTPESLQCPGFTEGYLPPLGPSGLPLLPVLFALGG
LLLLSNASCVGGVLWQRRLRRLAEGISEKTEAGSEEDRVRNEYEESQWTGERDTRSSTVS
TTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGP
LYDEVQMGPRDLRWPEDTYQDPRGIYDQVAGDLDTLEPDSLPFELRGHLV
Download sequence
Identical sequences ENSGGOP00000028097 ENSGGOP00000012444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]