SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028113 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028113
Domain Number 1 Region: 513-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily POZ domain 8.37e-21
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 3 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 390-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000087
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 358-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000184
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 475-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000716
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028113
Domain Number - Region: 325-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.049
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028113   Gene: ENSGGOG00000000433   Transcript: ENSGGOT00000026902
Sequence length 647
Comment pep:known_by_projection chromosome:gorGor3.1:3:43698544:43707778:1 gene:ENSGGOG00000000433 transcript:ENSGGOT00000026902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNEQRLFQPDLCDVDLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLE
ALAPGGLQQILNFIYTSKLLVNAANVHEVLSAASLLQMADIAASCQELLDARSLGPPGPG
TVALAQPAASCTPAAPPYYCDIKQEADTPGLPKIYAREGPDPYSVRVEDGAGTAGGTVPA
TIGPAQPFFKEEKEGGVEEAGGPPASLCKLEGGEELEEELGGSGTYSRREQSQIIVEVNL
NNQTLHVSTGPEGKPGAGPSPATVVLGREDGLQRHSDEEEEDDEEEEEEEEEEEGGGSGR
EEEEEEEEGGSQGEEEEEEEDGHSEQEEEEEEKQHHPCQKCPRVFNNRWYLEKHMNVTHS
RMQICDQCGKRFLLESELLLHRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKF
SCEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCEN
CNERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKS
FTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVSHTLAGDGVPAAPGL
PPTQPQAHALPLLPGLPQTLPPPPHLPPPPPLFPTTASPGGRMNANN
Download sequence
Identical sequences ENSGGOP00000028113 ENSGGOP00000000429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]