SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028136 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028136
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily TRAF domain-like 2.13e-46
Family MATH domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 180-295
Classification Level Classification E-value
Superfamily POZ domain 6.59e-34
Family BTB/POZ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028136   Gene: ENSGGOG00000016285   Transcript: ENSGGOT00000030230
Sequence length 392
Comment pep:known_by_projection chromosome:gorGor3.1:2b:25645112:25716861:1 gene:ENSGGOG00000016285 transcript:ENSGGOT00000030230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNGNQATDIMETSGWKSMI
QSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
Download sequence
Identical sequences G3SJ46
XP_018878328.1.27298 ENSGGOP00000028136 ENSGGOP00000028136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]