SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028172 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028172
Domain Number 1 Region: 26-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family V set domains (antibody variable domain-like) 0.0047
Further Details:      
 
Domain Number 2 Region: 137-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000211
Family I set domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028172   Gene: ENSGGOG00000004520   Transcript: ENSGGOT00000026251
Sequence length 319
Comment pep:known_by_projection chromosome:gorGor3.1:1:146216185:146257182:-1 gene:ENSGGOG00000004520 transcript:ENSGGOT00000026251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDK
LLLTHTERVVIWQFSNKNYIYGELYKNRVSISSNAEQSDASITIDQLTMADNGTYECSVS
LMSDLEGTTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNI
LNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVG
IAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNRAAYEEPPEQLRELPREREEEDD
YRQEEQRSTGRESPDHLDQ
Download sequence
Identical sequences G3SJ82
XP_004027888.1.27298 ENSGGOP00000028172 ENSGGOP00000004431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]