SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028222 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028222
Domain Number 1 Region: 42-229
Classification Level Classification E-value
Superfamily L domain-like 3.81e-40
Family Ngr ectodomain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 253-292,320-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000283
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028222
Domain Number - Region: 530-569
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00665
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028222   Gene: ENSGGOG00000002883   Transcript: ENSGGOT00000023391
Sequence length 745
Comment pep:known_by_projection chromosome:gorGor3.1:15:53722133:53756191:1 gene:ENSGGOG00000002883 transcript:ENSGGOT00000023391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKIAVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYH
NPFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCAPPSVHLSAE
PPLEAPGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGAEEG
EGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNE
LGANSTSIRVAVAATGPPKHAPGAGGEPEGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQ
GLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELK
PHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAGGARRPGRRPLRLLYLCPAGGGAA
VQWSRVEEGVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFL
LVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPA
GGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYS
DRLPLGAEAVNIAQEINGNYRQTAG
Download sequence
Identical sequences ENSGGOP00000002833 ENSGGOP00000028222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]