SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028228 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028228
Domain Number 1 Region: 15-110
Classification Level Classification E-value
Superfamily Immunoglobulin 6.35e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 2 Region: 112-208
Classification Level Classification E-value
Superfamily Immunoglobulin 7.12e-19
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028228   Gene: ENSGGOG00000026423   Transcript: ENSGGOT00000034105
Sequence length 260
Comment pep:known_by_projection chromosome:gorGor3.1:19:51535431:51541403:-1 gene:ENSGGOG00000026423 transcript:ENSGGOT00000034105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCVGQGDTRGDGSLPKPSLSAWPSSVVPANSNVTLRCWTPARGVSFVLRKGGIILESPK
PLDSTEGAAEFHLNNLKVINAGEYTCEYYRKASPHILSQRSDVFLLLVTGHLSKPFLRTY
QRGTVTAGGRVTLQCQKRDQLFVPIMFALLKAGTPSPIQLQSPAGKEIDFSLVDVTAGDA
GNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYTLGNFIRLGLAAIIVVIMGAFL
VEAWYSRNVSPGESEAFKPE
Download sequence
Identical sequences ENSGGOP00000028228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]