SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028229 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028229
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-30
Family Dual specificity phosphatase-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028229   Gene: ENSGGOG00000004744   Transcript: ENSGGOT00000029803
Sequence length 141
Comment pep:known_by_projection chromosome:gorGor3.1:6:179714:227316:1 gene:ENSGGOG00000004744 transcript:ENSGGOT00000029803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYI
MTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAE
EAKNILAAPGILKFWAFLRRL
Download sequence
Identical sequences ENSGGOP00000028229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]