SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028231 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028231
Domain Number 1 Region: 28-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-20
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 147-239
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-20
Family I set domains 0.0046
Further Details:      
 
Domain Number 3 Region: 244-362
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-16
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028231   Gene: ENSGGOG00000010340   Transcript: ENSGGOT00000032343
Sequence length 486
Comment pep:known_by_projection chromosome:gorGor3.1:4:1026675:1038931:1 gene:ENSGGOG00000010340 transcript:ENSGGOT00000032343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSPLLLLLLPPLLLGAFPPAAAARGPPRMADKVVPRQVARLGRTVRLQCPVEGDPPPL
TMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDI
SPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRP
DITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQ
RTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG
QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPK
PPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPL
GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKVEGKVHQ
HIHYQC
Download sequence
Identical sequences ENSGGOP00000028231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]