SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028308 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028308
Domain Number 1 Region: 373-533
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.26e-57
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000711
Further Details:      
 
Domain Number 2 Region: 112-217
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-31
Family SH2 domain 0.000000695
Further Details:      
 
Domain Number 3 Region: 5-106
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-29
Family SH2 domain 0.00000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028308   Gene: ENSGGOG00000010689   Transcript: ENSGGOT00000023838
Sequence length 601
Comment pep:novel chromosome:gorGor3.1:12:112029146:112088731:1 gene:ENSGGOG00000010689 transcript:ENSGGOT00000023838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFFLRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSESRWFHGHLSG
KEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKY
DVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAET
TDKVKQGFWEEFETLQQQECKLLYSRKEGQRQKKKGRLCEYSQSCKAVPFMHTIFIQLTN
KACLPIVHMSHSDVSSDEHLISLKRRSLKQKRHYSFKTRGCLTNSHCKFYSCKFLCLPKI
QELTFFFSDPFQSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTE
RTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVI
DILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEE
QKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSF
R
Download sequence
Identical sequences ENSGGOP00000028308 ENSGGOP00000028308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]