SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028421 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028421
Domain Number 1 Region: 118-213
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-25
Family I set domains 0.0002
Further Details:      
 
Domain Number 2 Region: 302-399
Classification Level Classification E-value
Superfamily Immunoglobulin 4.34e-20
Family I set domains 0.00057
Further Details:      
 
Domain Number 3 Region: 216-299
Classification Level Classification E-value
Superfamily Immunoglobulin 7.73e-18
Family I set domains 0.0021
Further Details:      
 
Domain Number 4 Region: 26-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000731
Family I set domains 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028421   Gene: ENSGGOG00000013789   Transcript: ENSGGOT00000034573
Sequence length 449
Comment pep:novel chromosome:gorGor3.1:19:52200493:52204957:1 gene:ENSGGOG00000013789 transcript:ENSGGOT00000034573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAALTALLCFRLSLGPRTHVQAGPFPKPTLAETVSVISWRSPMTIWCGTLEAQEYYLYK
EGSTEPCDRTNPLETRNKARFSIPSMTQHHAGRYQCYYLSPAGSEPSDPLGLVVTGFYNK
PTLSALPSPVVASGGKVTLRCGSQKGYDHFVLMKEEHQLPQTLDSQQLHSGGFQALFPVG
PMTPSHRWRFRCYGYYRNTPQVWSRPSDPLEILPSAPGETLTLQCGSDVGYDRFTLYKEG
ERDFLQRPGRQPQAGLSQANFTLGPVSLSHGGQYRCSGAHNLSSEWLAPSDPLNILIAGQ
IPGRPSLSVQLWPTVVSGEVTLLCQSQEWMRTFLLTKEGAAHPLLCPRSKYGAHKYQAEF
PMSPVTSAHTGTYRCYGSLSSNPYLLSHPSEPLELVVSGASGPSPSHLQDYAVENLIRMG
VAGLILVVLGILLFEAWHSQRSSQDAARR
Download sequence
Identical sequences ENSGGOP00000028421 ENSGGOP00000028421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]