SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028443 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028443
Domain Number 1 Region: 115-201
Classification Level Classification E-value
Superfamily Immunoglobulin 2.32e-18
Family I set domains 0.0000054
Further Details:      
 
Domain Number 2 Region: 29-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000102
Family I set domains 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028443   Gene: ENSGGOG00000021999   Transcript: ENSGGOT00000031982
Sequence length 260
Comment pep:known_by_projection chromosome:gorGor3.1:1:138301293:138319814:1 gene:ENSGGOG00000021999 transcript:ENSGGOT00000031982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKMAPAMESPTLLCVALLFFAPDGVLAVPQKPMVSLNPPWNRIFKGENVTLTCNGNNFF
EVSSTKWFHNGSLSEEKHSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQA
SAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCT
GKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVAILFAVDTGLFISTQQQVTFLLKIK
RTRKGFRLLNPHPKPNPKNN
Download sequence
Identical sequences XP_004027113.1.27298 ENSGGOP00000028443 ENSGGOP00000028443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]