SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028531
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.3e-18
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number 2 Region: 174-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000551
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028531   Gene: ENSGGOG00000005924   Transcript: ENSGGOT00000029335
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:1:114460406:114481227:-1 gene:ENSGGOG00000005924 transcript:ENSGGOT00000029335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRFRI
PGLPGCILSFQLKVCFLPVMWLFILLSLALISDAMVMDEKVKKSFVLDTAFAICNYNAHY
KNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRD
FARDDMDFTELIVTDDKGTLASDFWSGKDLSGNKTRSCKAPKVVHKADRSRTSILIICIL
ITGLGIISVISHLTKRRRSQRNRRVGNALKPFSRVLTPKEMAPTEQM
Download sequence
Identical sequences G3QSZ8
ENSGGOP00000028531 ENSGGOP00000005800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]