SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028540 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028540
Domain Number 1 Region: 274-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.22e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028540   Gene: ENSGGOG00000000580   Transcript: ENSGGOT00000034651
Sequence length 1169
Comment pep:known_by_projection chromosome:gorGor3.1:1:7917524:7975024:1 gene:ENSGGOG00000000580 transcript:ENSGGOT00000034651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RXFVFGAGVFSAXDEALGEESGKRWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEM
KKYFPSERRNKPSTLDALKYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAAIA
SEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDVRVFYAH
TARAQLPFWNNWTQRAAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHPA
QPESESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQD
LIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFVN
PWSRKVSFIIGRHKVRTPPSNSTCLCIVYMNMNLRTVDLPHTQQHIYSLARDPACIALSK
FSQLGICKSHKAICSISISLKKQIPNTSERFSSSQCVYIRNQQIKNKSKKVYVLNYMLGT
FNCTSLYSVSGECKTFTSFHQTLKNNSVYTEPCEDWRNDEHSPSYQQINCIDSVIRYLKS
YNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAPAGLQIPAIPKSEMPTNGRSID
TGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQPAPLTSE
EFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYFQGDSTSK
QTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHTSSPTFPP
AAMVPSQAPCLVPAFPLPAATSPGREYAAPGTAPEGLHGPPLSEGLQPYPAFPFPYLDTF
MTVFLPDPPVCPLLSPSFFPCPFLGATASSAISPSMSSAMSPTLDPPASVTSQRREEEKW
EAQSEGPPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQAEYCVTGNNGSESSPA
TTGALSTGSPPRENPSHPTASALSTGSPPMENPSHPTASTLSMGLPPSGTVLSTGSPPSE
SPSRTGSAASGSSDSSIYLTSSVYSSKISQNGQQSQDVQKKETFPNVAEEPIWRMIRQIP
ERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEID
IQACVTCENEDSADGAATSCGQVLVEDSS
Download sequence
Identical sequences ENSGGOP00000028540 ENSGGOP00000000574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]