SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028543 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028543
Domain Number 1 Region: 29-227
Classification Level Classification E-value
Superfamily L domain-like 1.02e-35
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 328-406
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000344
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 3 Region: 230-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000108
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028543   Gene: ENSGGOG00000024235   Transcript: ENSGGOT00000030655
Sequence length 532
Comment pep:known_by_projection chromosome:gorGor3.1:19:33240595:33246488:1 gene:ENSGGOG00000024235 transcript:ENSGGOT00000030655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILPLLLCLLPLAPASSPPQSATPSPCLSRNTIRHVAAGAFADLRALRALHLDGNRLTS
LGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLGN
VNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPASA
LVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVRWVSPQGRL
LGNSSRARAFPNGTLELLVTEPGDGGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTS
CDPPRDGDPDALTPPSAASASAKVADTGPPTDRGVQVTEHGATAALVQWPDQRPIPGIRM
YQIQYNSSADDILVYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCA
RFSTEPALRPCGAPHAPFLGGTMIIALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKIP
APVSSVCSQTNGALGPTPTPAPPAPEPAALRAHTVVQLDCEPWGPGHEPVGP
Download sequence
Identical sequences ENSGGOP00000022050 ENSGGOP00000028543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]