SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028585 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028585
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-37
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 479-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000471
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028585
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00322
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028585   Gene: ENSGGOG00000034947   Transcript: ENSGGOT00000041079
Sequence length 668
Comment pep:known_by_projection chromosome:gorGor3.1:11:20961890:21879217:1 gene:ENSGGOG00000034947 transcript:ENSGGOT00000041079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIITELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHNGKPRTEALPYRMADGRWHKVALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTMCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCK
VRLMWCSR
Download sequence
Identical sequences ENSGGOP00000028585 ENSGGOP00000028585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]