SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028586 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028586
Domain Number 1 Region: 29-129,166-183
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-29
Family FKBP immunophilin/proline isomerase 0.00055
Further Details:      
 
Domain Number 2 Region: 162-250
Classification Level Classification E-value
Superfamily EF-hand 0.000000000128
Family Calbindin D9K 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028586   Gene: ENSGGOG00000034906   Transcript: ENSGGOT00000041013
Sequence length 257
Comment pep:known_by_projection chromosome:gorGor3.1:2b:66491867:66504819:-1 gene:ENSGGOG00000034906 transcript:ENSGGOT00000041013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYGILEEVFLLQNILVSCHRTTLHVLKCMLVLNNNTCAEGKIPPDATLIFEIELYAVT
KGPRSIETFKQIDTDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDG
DGFISPKEYNVYQHDEL
Download sequence
Identical sequences ENSGGOP00000028586 ENSGGOP00000028586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]