SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028688 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028688
Domain Number 1 Region: 549-821
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-86
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 75-161
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000288
Family SEA domain 0.0063
Further Details:      
 
Domain Number 3 Region: 336-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000301
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 4 Region: 485-516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 521-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 234-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000017
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 450-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028688   Gene: ENSGGOG00000034825   Transcript: ENSGGOT00000041132
Sequence length 822
Comment pep:known_by_projection chromosome:gorGor3.1:22:21325106:21414663:-1 gene:ENSGGOG00000034825 transcript:ENSGGOT00000041132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAEAPQVAGGQGDGGNGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAG
VLLWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITST
RLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAV
PYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHL
QGPEDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMA
VVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWH
LTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAERIPVVATAG
ITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNC
VCRATFQCKEDSTCISLPKVCDGQPDCFNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNP
QCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIAD
RWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDV
ALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGEQRALAAGGGGSHFC
PPRTGPISNALQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYLKGKKDACQGDSGGPLVCK
ALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences ENSGGOP00000028688 ENSGGOP00000028688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]