SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028724 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028724
Domain Number 1 Region: 581-672
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-21
Family I set domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028724   Gene: ENSGGOG00000034812   Transcript: ENSGGOT00000040992
Sequence length 674
Comment pep:known_by_projection chromosome:gorGor3.1:1:80197499:80226542:1 gene:ENSGGOG00000034812 transcript:ENSGGOT00000040992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQVSLKIKFVFVSEKEGDDSLLITVVPVKSYKT
SGKMKKNFEDLEKEREEKERIKYEEDKRIRYEEQRRSLKEAKCLSLVMDDEIESEAKKES
LSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEEEENQDTAKI
FKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEMY
KTISQESLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEEE
NETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLEI
KEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRMQ
FEQREIDAALQKKREEEEEEEGSIMNGSTTEDEEQTRSGAPWFKKPLKNTSVVDSEPVRF
TVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNKG
SAASTCILTIESKN
Download sequence
Identical sequences ENSGGOP00000028724 ENSGGOP00000028724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]